SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102735
Domain Number - Region: 366-461
Classification Level Classification E-value
Superfamily Acid proteases 0.000354
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 
Domain Number - Region: 46-75
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102735
Sequence length 517
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKANMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIQQGIICWKDWKIALKDREDLLQTNFGKGGMRALVQDYLKEHETV
VGESASYGARVDDEIGGSTETSEFWASSFSTMQEGKLPREALLRTAATIRRRTGWEDPVD
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASL
VEKTTETKDKGKSIAYKLLSDIEAATNLKGMLEERILNAKVEFTLKEVLGIAKKEFHDVI
IDSIKRKRQLMGESGMSHAIDARICRDEEENRYNQRVCFEDSSDKKMETLSHYTRKHWAR
ATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELY
GACPDVKIQIGDVATEQHFFVQDTTSYPLILGQPYITATRMEIKVLDDGSAYARVRSEDG
RKAVQFLTVPPNHERNRDRLREKPLPKIVERFKDFGE
Download sequence
Identical sequences A9U5M0
3218.JGI102735 jgi|Phypa1_1|102735|fgenesh1_pg.scaffold_721000001 XP_001786155.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]