SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102750
Domain Number - Region: 46-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00785
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 211-306
Classification Level Classification E-value
Superfamily YwmB-like 0.0458
Family YwmB-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102750
Sequence length 319
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKSDMGMEEIIREMRDLQIKLARLEENTSTNNLKNVSKQEYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKVALKDREDLLQTNFSKGRMRALVQDYLKEHETV
ARENASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRETKDKGKSIAYKLLSDIEAATNLK
GVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEE
EVDIGYKQPTNEKNGYNQR
Download sequence
Identical sequences A9U5N1
XP_001786166.1.60028 jgi|Phypa1_1|102750|fgenesh1_pg.scaffold_746000001 3218.JGI102750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]