SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102818
Domain Number - Region: 253-291
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0102
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 271-322
Classification Level Classification E-value
Superfamily Hepatitis B viral capsid (hbcag) 0.0667
Family Hepatitis B viral capsid (hbcag) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102818
Sequence length 381
Comment (Physcomitrella patens)
Sequence
MDPSIASMFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSENKMVALFGLATIPEIRDHITSITDHYGNSWEDFSHALKDEYFLEDADRVTKKLF
LRWIERPNKNLQATELLREFERQYSQLSKILEPLLEDKEEDEGLTTKWKNVEDAVGLLTK
KERRKDRSNIPKIVQASKAPIRTTPLTIPTVQPLTSLSKKADMGMEEIIRGMRDLQIKLA
RLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWNDGKIALKDR
EDLLQTNFGKEGVRALVQDYLKGHETVARESASYGARVDDEIGGSTETSEFWASAVSTMQ
EGKLSREALLRTAATIRGRTG
Download sequence
Identical sequences A9U5T5
jgi|Phypa1_1|102818|fgenesh1_pg.scaffold_815000003 3218.JGI102818 XP_001786221.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]