SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102832
Domain Number - Region: 139-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000968
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102832
Sequence length 281
Comment (Physcomitrella patens)
Sequence
MFVKEAQSATIASSLERAKVWKECHYDQNLILRAMMIPSQGGYQMTNWNDTSESYLGRND
YGTIPQGIVDSVPLQAVPPSSLHPYAPYSTYQEPIPMKELSNALVSRDPNDSLLLTLTKK
MDELVVNLGKDKEKRHKPTNMCPNVWCSNCKGQDHLVTECPSPPQMTVQCIFCRGKHITI
NCWNLQKQQQLSNQIMTQPIQWDVNQQMQTSQPAEDKGPVQRDSPVQCVEVVNVVLTRGQ
QKDKNPIQDMDEPIAEEQVAPSTGLNEPISILRHLPILRLQ
Download sequence
Identical sequences A9U5U9
3218.JGI102832 XP_001786234.1.60028 jgi|Phypa1_1|102832|fgenesh1_pg.scaffold_832000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]