SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102835
Domain Number - Region: 190-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102835
Sequence length 338
Comment (Physcomitrella patens)
Sequence
MIERKLWNPKHCKQWSIKLINLMGGIFQDKYFLEDADCVTKKLFLEWIERPNKNLQATEL
LREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKIELLLEDKEEDEGLTTKWKNVE
DAVELLTKREKRSNKQYSENSTSTQSSIQPSTSLSKKANMGMEEIIRGMRDLQIKLARLE
ENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKNREDL
LQTNFGKERMRALVQDYLKEHETAARESASYGARVDDEIGGSMETSEFWASVVSTMQEGK
LPREALLRTAATIREKEILLRGKFEETRLERQLHKNCL
Download sequence
Identical sequences A9U5V2
jgi|Phypa1_1|102835|fgenesh1_pg.scaffold_836000001 3218.JGI102835 XP_001786237.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]