SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102875
Domain Number - Region: 408-492
Classification Level Classification E-value
Superfamily Acid proteases 0.0141
Family Retroviral protease (retropepsin) 0.084
Further Details:      
 
Domain Number - Region: 112-151
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0147
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102875
Sequence length 532
Comment (Physcomitrella patens)
Sequence
ATDGELQGKLELLLEDKEEDEGLTTKWKNVEDTVGLLTKRERKKDRSNIPKTVQASKAPV
RTTPPTMPTIQPSTSLSKKADMGMEEIIRGMRDLQIKLVRLEENTSINNSKNVSKQGYVQ
RCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKNRDDLLQTNFGKGGMRALVQDYL
KEHETAARESASYGARVDDEIGGSTETSEFWASAISTMQEGKLPREALLRSAATIRGVTE
KRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLL
SDIEAATNYKEVLEEQEFHDVIIDNIKRKRQLMGETGMSHAIDARIYKDEEEVDIGYEQP
TNEKNGYNQRVHFEDSSDKEMETLSHYTRKHWAKATTEVLVKVEDIEEPIVTLVDHGSEI
NLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVKIRIGDVAMEQHFFVQDTTS
YPLILGQPYITATRMETKLLDDGIEIPQQEDESDLDNEGDEDKLDKDVGDIF
Download sequence
Identical sequences A9U5X8
XP_001786263.1.60028 3218.JGI102875 jgi|Phypa1_1|102875|fgenesh1_pg.scaffold_877000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]