SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI103032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI103032
Domain Number 1 Region: 105-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000178
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI103032
Sequence length 183
Comment (Physcomitrella patens)
Sequence
MIPWQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKLI
PTKELTNELVSRDPNESLLLTLTKKMDELVVNLAKDKEKRHKPTNMQPNVWCSNCKGQGH
LVTECSSPPQMMVQCTFCGDPNKPTGGGQRSCSTGLTSTSRRGGERSTYQGPTERQESNS
GPG
Download sequence
Identical sequences A9U664
XP_001786349.1.60028 3218.JGI103032 jgi|Phypa1_1|103032|fgenesh1_pg.scaffold_1083000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]