SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI103037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI103037
Domain Number - Region: 163-201
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00889
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI103037
Sequence length 287
Comment (Physcomitrella patens)
Sequence
MGEASKEASLRDPMSIGHQFTEETLEELKIGSDGSLLPEEITCFKKMLAKQATDGELQGK
LELLLEDKEEDEGLTTKWKNVEDAMGLLTKKERRKDRSNIPKTVQAPKAPVRTTPPTMPT
VQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDAS
HTRKDCNEFNNMIRHGIICWKDGMIALKNREDLLQTNFGKGGMKALVQDYLKEHETVARE
SASYGARVDDEIGGITKTSEFWASAVSTMQEGKLPREALLRTAATIR
Download sequence
Identical sequences A9U666
jgi|Phypa1_1|103037|fgenesh1_pg.scaffold_1091000001 3218.JGI103037 XP_001786351.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]