SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI103131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI103131
Domain Number 1 Region: 142-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000162
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI103131
Sequence length 201
Comment (Physcomitrella patens)
Sequence
MFVKEAQSATIASSLERAKVWEECHYDQNLIVGAMMIPSQGGYQMTNWNDASRSYLGRNE
YGTIPQGIVDVVPLQAVPPSSSHSYAPYSMYQKSISTKKLPNALVSRNPNESLLLTLTKK
MDELAVNLAKDKEKRHKPTNMRLNVWCSNCKGQGHLVTECPLPPQMTVQCTFCGGKHITT
NCWNLWKQQQFNNQIMTQPTL
Download sequence
Identical sequences A9U6B9
3218.JGI103131 XP_001786403.1.60028 jgi|Phypa1_1|103131|fgenesh1_pg.scaffold_1314000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]