SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI103558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI103558
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.84e-27
Family D-glucarate dehydratase-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI103558
Sequence length 181
Comment (Physcomitrella patens)
Sequence
MIDANNAYNLNLTKEVLAALTDVNLYWLEEAFHEDEALYEDLKEWLRQRGQHVLIADGEG
LASPHLVEWAIRGCVDVLQYDIISPGFMHWMELGEKLDAHGLRSAPHCYGNAYGIYASGH
LSAAVQNFEFVEYDDITIEGMDVSGYRIENGEIHIPATPGFGIVFDDELVTNLIKQSGWS
L
Download sequence
Identical sequences A9U6V5
3218.JGI103558 PP1S2988_1V6.1 XP_001786590.1.60028 jgi|Phypa1_1|103558|fgenesh1_pg.scaffold_2988000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]