SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI118845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI118845
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.85e-36
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 105-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000458
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI118845
Sequence length 161
Comment (Physcomitrella patens)
Sequence
MAEVEEFRCFVGGLSWNTTDKGLEEEFRRFGNVLEAKVIVDKETGHSRGFGFVNFGDERS
MDEAIERLHGKELDGRPITVNRAKPKGRDGGGDRGGGGGGGGGGGGKGGGGGGGGGGGGG
GDCFKCGQPGHWARECPTGGGDRGGGGRYSGRDRYDSGRLA
Download sequence
Identical sequences A9RSY7
PP1S26_263V6.1 jgi|Phypa1_1|118845|e_gw1.26.120.1 XP_001757165.1.60028 3218.JGI118845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]