SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI123572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI123572
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.34e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.0000228
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-26
Family Canonical RBD 0.0067
Further Details:      
 
Domain Number 3 Region: 338-360
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI123572
Sequence length 388
Comment (Physcomitrella patens)
Sequence
MAVMLVTSVGELVVDLFTDLCPLATKNFLKLCKIKYYNNCLFHSVQKDFIVQTGDPTGTG
KGGDSVYKLLYGDQARFFDDEFHPTLKHDKVGIVAMASAGENANASQFYITTRAELDYLD
EKHTVFGEVGEGLDTLMRINEAFVDDNFRPFKNIRIKHTIILDDPFDDPAGLADLIPEKS
PELKPPADEVRLEDDWVPMDETMDPEELEKSLRKKEAQSRAVVLEMIGDLPEADMKPPEN
VLFVCKLNPVTEEGDLELIFGRFGKVKSADIIRDYKTGDSLCYAFIEFETEEACEAAYFK
MDNVLIDDRRIHVDFSQSVSHLWNRYRKLGKAGGDAANGGKGCFKCGEVGHFAKECPNNG
TEQKEGPTEKPKYTIKDTGGQRGHAHKK
Download sequence
Identical sequences A9S3K5
3218.JGI123572 XP_001760964.1.60028 jgi|Phypa1_1|123572|e_gw1.45.68.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]