SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI125455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI125455
Domain Number 1 Region: 126-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.98e-70
Family Tandem AAA-ATPase domain 0.00014
Further Details:      
 
Weak hits

Sequence:  3218.JGI125455
Domain Number - Region: 670-687
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000558
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number - Region: 484-558
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00384
Family GUCT domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI125455
Sequence length 689
Comment (Physcomitrella patens)
Sequence
MERSAIATDYASTSIFGLTDGLDTDEFDDEEEIIRVDNESVDDEDELAVANLGIPQAVVD
ALAKRGIEKLFPIQRAVLDPAMQGRDLIGRAKTGTGKTLAFGIPIIHNILKAHEADRTSR
RSGRAPRALVLAPTRELAKQVEREFMESAPMLSTVCVYGGVSITTQQRQLQRGVDVAVGT
PGRIIDLIERRSLSLRDVSYLVLDEADQMLAVGFEEDVERILEQMPEERQSMLFSATMPN
WVKKLSKKYLKSPLTIDLVGDSNEKLAEGIKMLAVCIPPAAKRTVLNDLISVHGSVGKTI
VFTQTKRDADDVASVLGRTLGCEALHGDITQSQRERTLASFREGRFSVLVATDVAARGLD
IPNVDLVVHYEIPNDPETFVHRSGRTGRAGKDGTAILMFSENQKRTMRNIEMDVGCKFTL
MSPPQMEEVLQASSKAAKAVIQRVNPDVANVFLSTAEKLLEKEGPGAFAAALAHLSGFSQ
LPAPRSLITHEEGLITLRMVRTEELPRAMSARMVMGVLADIWDAAADNVGKIRIIDDPKI
QGAVFDLPQEIAKELLTKPRREEDVIESIKKLPKLVDLDGDRGRGSDRYGRFGSRGGSGM
RSSSPRGGRGGPSRGRDSGWSNDGDRSGRRSSERYQLLSLPPDLSKHYVDFLLFLSSLMA
ISHCRRSSFAGVCFICNQPGHRAADCKGQ
Download sequence
Identical sequences A9S7H7
jgi|Phypa1_1|125455|e_gw1.54.23.1 3218.JGI125455 XP_001762375.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]