SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI130683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI130683
Domain Number 1 Region: 169-203
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000101
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI130683
Sequence length 244
Comment (Physcomitrella patens)
Sequence
MAIHFKFRSAVEYDSIDIDGPFISIGSLKEKIVEHKNLGMATDFDLLITNAQTAEEYSED
SFLLPKNTSVIIKRVPASRLKPVVRVQEHRPLRLNFTNTVIVVQNAGMDSLDDFGVDLYA
IPEPVVSKVDPDENIRIAAMVNTTASDWQRQTKEGLGGGRGSGRGGYGRGGRTFGRATPP
QGYVCHRCGQPGHFIQHCPTNGDPTFDMRKMKSPVGIPKTQLKADQEGSYILPDGSVAVM
QPDE
Download sequence
Identical sequences A9SJ41
XP_001766452.1.60028 3218.JGI130683 jgi|Phypa1_1|130683|e_gw1.84.86.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]