SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI135179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI135179
Domain Number 1 Region: 940-963
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000127
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI135179
Sequence length 1100
Comment (Physcomitrella patens)
Sequence
MVKLRMNTADVAAEVRCLRRLIGFRCANVYDLTPKTYVIKLSRSSGVTESGESERSLLLL
ESGVRFHTTEFARDKSTTPSGFTLKLRKHIRTRRLEDVRQLGIDRVIDLQFGMGEGTHHI
ILELYAQGNILLTDGDYNVLTLLRTHKDEDKGLVMMAKHEYPVNACRLFNRFSLEKLEAA
MRDQKTQADADEYIDAKEVKVKTSWGKKEDTGRTLKSVLGGCLGYGPALCEHIVLDSGLQ
SGMKVSLGPDGVLSISKENLGDLMGAISRFEDWLDSVVNGDRIPEGFVYMQKKNIKKDKV
LLDDQLQEEEKVYDEFSPLHLKQFDDRTVMRMETYDAALDEFFSKIEGQRAEQQRKAQED
SAFSKLDKIRADQTQRVEVLKQEVDQTVRMAELIEYNLEDVDNAILAVRSTVASGMDWKD
LARMIKEEKKAGNPVAGLIHSLQLEKNQITLLLSNNLDDMDDDEKTQPVSKVDVDIGLSA
HANARRWFEQKKKHAVKQDKTKAAHEKAFKAAEKKTLQQLAQAKSVAAISHMRKVHWFEK
FNWFVSSENYLIISGRDAQQNELVVKRYMRKGDLYVHADLHGASSTVIQNHNPLYPIPPL
TINQAGVFTVCRSQAWDSKIVTSAWWVEAHQVSKTAPTGEYLTVGSFMVRGKKNFLPPNP
LVMGFGVLFRLDDSSIAAHLNERRVRGEVEDDDTLTLVTSNNDVYSKTPDAIEELDGVGE
EEEQDIEFNEDEVADSKCPDVEVEIGNLDEKVDAGIEGEGSSDDASGLDALLDRALELRA
GPKRTDTNSKYGLDTLPAQVSDTEYDLPVAKASQREKPYISKAERRKAKKGGKVEKGSEK
DASAETVDGEEEKTSQEENLKTKSAIFKDDKMSESSPLGEKVGRGRKGKLKKIKAKYAEQ
DEDERELRMSLLAVSFNFPSMIHVKYYFIQDCWSLPYISGDAIALGSKVCYKCKKVGHLA
RDCTVTDVEPLLLAEENVQELGDDERDKLTELDSLTGCPTATDVLLYAVPVCAPYQALQG
YKYRVKLTPGNGKKGKVAKFAVDIFSHMQEITTREKELMKAMTDPELAACMIGNVKVTAP
GSTKLKQAQKKGKKASNKKE
Download sequence
Identical sequences A9STP2
XP_001769734.1.60028 jgi|Phypa1_1|135179|e_gw1.117.3.1 3218.JGI135179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]