SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI143157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI143157
Domain Number 1 Region: 82-263
Classification Level Classification E-value
Superfamily E set domains 7e-47
Family Cytoplasmic domain of inward rectifier potassium channel 0.00039
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000377
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI143157
Sequence length 264
Comment (Physcomitrella patens)
Sequence
MPTPRFVGILLLNYFFLFVGFGVPYYYDAYNNNCIPGVFTFDHALWFSVQTSMTIGYGGD
LTPDPSCRLTNIMVVVQSLASLLVAYSLLGVFYVRFSRPARRAQTIIFSRYCTMHEEDGV
PVISLRIANIRKHQIIEANVRLLIGFNNTLGGSDDETVFHFTSLPVIGGNQVFLGLPCTV
KHPITSTSPLYGMSITELEDADCELLVLLEGVDASTSCKLQARHSYLPKDIRQDVMHETM
VFRSPNGRRCVEFSKFDTLLPVSS
Download sequence
Identical sequences A9TBJ7
jgi|Phypa1_1|143157|e_gw1.199.75.1 3218.JGI143157 XP_001775971.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]