SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI143810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI143810
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-20
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 78-105
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000778
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI143810
Sequence length 174
Comment (Physcomitrella patens)
Sequence
MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG
KNGWRVELSRSSGGGGGPRGRGGDDMKCYECGEPGHFARECRLRIGAGGLGSGGRGKSPR
ASPRYRRSPSYGGRRSKSSPRLRSVSPVRRGRSPSRSPPPRRDRRGSPVANGYV
Download sequence
Identical sequences A9TD63
jgi|Phypa1_1|143810|e_gw1.207.127.1 3218.JGI143810 XP_001776556.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]