SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI147170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI147170
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-22
Family Canonical RBD 0.0045
Further Details:      
 
Domain Number 2 Region: 93-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-21
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 3 Region: 182-211
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000837
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI147170
Sequence length 213
Comment (Physcomitrella patens)
Sequence
KVMVGGMPYYITENDIHEFFQECGTIAELDCMTFPDTGKFKGIAFITFRTEEAAKRAMAL
DAADMGGRFLKIEMCKIKPLEVGNKPLFKEPPKKQPGCLAAYIGNLSYDITEKEVRRFFK
GCKIESVRFAENKETGEFRGFGHIDFADDESLEAAMKLDQEPLLGRPLKIAYSVPQKDKI
MGVRGGSKPAETKKGCFTCGEEGHMSYNCPLKI
Download sequence
Identical sequences A9TKZ3
XP_001779298.1.60028 jgi|Phypa1_1|147170|e_gw1.255.64.1 3218.JGI147170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]