SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI151194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI151194
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.9e-20
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 78-105
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000117
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI151194
Sequence length 224
Comment (Physcomitrella patens)
Sequence
MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG
KNGWRVELSRSSGGGGGPRGRGGDDMKCYECGEPGHFARECRLRIGAGGLGTGGRGKSPR
ASPRYRRSPSYGARRSKSSPRLRSVSPVARRGRSPSRSPPPRRDRRGSPVGNGYAASPRR
DRRGSPVVNGYVLLAVPFLYFYGVKWFYTHWWLLSLVILKPNYV
Download sequence
Identical sequences A9TV47
jgi|Phypa1_1|151194|e_gw1.332.33.1 3218.JGI151194 XP_001782492.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]