SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI155610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI155610
Domain Number 1 Region: 7-605
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 2.09e-150
Family Prokaryotic type I DNA topoisomerase 0.0000339
Further Details:      
 
Domain Number 2 Region: 889-913
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000611
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Domain Number 3 Region: 760-787
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000942
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  3218.JGI155610
Domain Number - Region: 642-674
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0221
Family Transcriptional factor domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI155610
Sequence length 915
Comment (Physcomitrella patens)
Sequence
MARPIRVLNVAEKPSVAKSVAVILSRGNVRTRNGRSVYNKIFEFGYTIGGQQCDMLMTSV
TGHLMELDFEDQFRKWHSCDPVDLFQAPVRKKVPQDKVNLQKTLEEEARHCQWLVLWLDC
DREGENIAYEVVDVCRASNARINIWRAHFSALIDREIHHAVQHLGRPNKMYADAVDARQE
IDLRIGASFTRFQTMLLSDSFVMPFGEDDKKLVLSYGPCQFPTLGFVVERYWQIQAHVAE
DFWAIKCFHKAEDGSAEFSWARGRLFDELAAFIIYEMCMERPTATVCQVTGQEKRKFPPV
PLNTVELQKRASRYFRMGYILNYEAVRSQFLQVAEELYQAGFISYPRTETDKFSENQDLQ
SIVNEQIGHSAWGQYAQRLLDPQQQLWKQPGDGGHDDKAHPPIHPTRFSEGEGNWTNDHA
RIYELVVRHFLACVSQPAIGYGTTATIDIAGERFTATGLMITAKNYLDVYRFDNWGTSTI
PKFEVGQQFIPTRLTLEVGRTQPPPLLSEADLISLMDKAGIGTDATMHDHIKKLLDRCYA
TKDANTRFCPTTLGEALVMGYDSMGHELWKPDLRALMESDMKAVSDGRKTKPQVLEAALE
GMKSLFISARTQKEKLLDAMGIFFERSAGGDEQRQAGERVRLCPLCQQNTMILRKKPDGK
FMVGCSGYPNCRNVVWLPGPAIEASVTNQPCISCGPGQVLKIYLKFRRGEIPPNFDVEHT
GCVGCDRVIKELIEICGTAGGSGYMSGNSNGFGNNSSFVTGREASQRNCTNCGQSGHYNM
DCPRNQQGRVSNRNQDRRRNDPSVPPASVRCDCGKPCKLLTANTEANRGRRFHRCPTGEC
EFFQERASTKTTVRSRSTRTVVSSSSGSSRSSGARGGQSNSSRGTFVSATGESAGSCFKC
GQSGHWANACPSRNM
Download sequence
Identical sequences A9U3P7
jgi|Phypa1_1|155610|e_gw1.475.3.1 XP_001785482.1.60028 3218.JGI155610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]