SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI160321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI160321
Domain Number 1 Region: 308-344
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000055
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 
Domain Number 2 Region: 351-383
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000327
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI160321
Sequence length 452
Comment (Physcomitrella patens)
Sequence
MGDGARFDLSAAQKTSDFNVAYVTSRPLDERMKLTGYDRSYVCSLKSADPARRRPDPARR
RPDPGQKEPTAQARLTEHRRRASEGWRLNIDRDNDPAVEPHARGWSVGVWGVLACRLSGS
SVCLMSYTEEDTAGRPKLSLQPRGSASDIASSSPAKSSRPNPFGAARPREQVIAERTGKK
EQEILKEQAAKEWKKNIVLTEQQREEKKAAEAELSFARSELVKEVDPTKSKALREEVNLM
EKKLDELLASFEEIAVQTAQSGGSRRPRREDERPPAAVGSAYGSSEPEGYSNFSRSRERD
GIRGSSYGDTWGGVKGGNKGQEGCYNCREVGHFSRECPNPVGSRGGAGAYGGNFGGGGGG
RPCYTCGQEGHMARECPQGANVGGYGSRGAGGGSSYGGAYGGGGYGGGYGGGGTYDDTTQ
YGASQGGGYGAGSYDDRRYSSGGRSGNYNQSW
Download sequence
Identical sequences A9RPZ4
jgi|Phypa1_1|160321|estExt_fgenesh1_pg.C_210077 XP_001756078.1.60028 3218.JGI160321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]