SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI166348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI166348
Domain Number 1 Region: 595-808
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000004
Family DNase I-like 0.069
Further Details:      
 
Weak hits

Sequence:  3218.JGI166348
Domain Number - Region: 349-371
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0235
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI166348
Sequence length 816
Comment (Physcomitrella patens)
Sequence
MQASTGRGSRAEPTKDLHRKDIPRETLRFGPYTSRRRENTVQRHFSTKTKSYSRALRTQN
QQGQMRALTSGTTEQHHLLSSSNRPSIPPPNVISRQTSPMDNKGTPRTGTIRHTNYWDFG
TSATMSSNGQQIQAVNSPTPHITDNPNSHMDTLIIQKALDLAHHTMENLRVFIQAKWDTA
EAFIKQNPQLGLLHQYTVEEELQRLSEQLKPDAENLLQAYGIDTGTIGNTITSPPKDATF
SQPQPAHNTIKATLSMNTLQQLQEQITHEEKHTLIGYLKKNPGPRILHEWATQLLHNSYS
SITMLGGGYFEVLVYGYWWTTSQKLPQSMILPNFLGGEKEYIIEYSGLPNQCNRCRSTSH
HAKNCPLSRSKEGKRPRSKPTHSESSNEINPTPDRETSKTSGSDPRPISYDSPLIHPKFW
QALKLQQPHGSISQGHITPVLVRIAPDLSMETLVHKHNDSPLCKLQLHQVLNETTWSKTS
ARTHMVNTTMQGLRTVITNMNNGPNLSRQWTDVIWLSDWKTTETLPVCDWIVIIPFDDQR
TQIKPTNSVYWKTHFPSENPQAPILERLQASTHSDWSSVFGTQQCLGKGLAGVRKRRELR
DLMQNIHPRPDVLLLQEHRFTHNDCLERSSQLEFMKDPLLWNAAVYSATNDSLAGGTAIL
TSSKLAPLIQEHGVIVRGQAQYAVFEFTPTMRIGIINVYGYNHTGPRARLWQKITDYPLP
PALWIMGGDLNFIESLEDKQGGNNNLGRGRREVESWNNLLIRLQLQYSFHMDEFHKINAK
SFTWDNRGLAPKTVLIRLDRFYICDKLQDRGGMIGI
Download sequence
Identical sequences A9SSN9
3218.JGI166348 jgi|Phypa1_1|166348|estExt_fgenesh1_pg.C_1140028 XP_001769420.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]