SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI166998 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI166998
Domain Number - Region: 113-149
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00575
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI166998
Sequence length 198
Comment (Physcomitrella patens)
Sequence
MENYLKEIKSIMDQLEAILVTLPEDLLSLLLLHSLPREYQPSESYLRVMTISLPSQKLLD
EEMQIRMDTEKETSEEVLWMRKGNSSSSNKRATTARFLRGSRPSTEPKLQFGRGSKNRTQ
PPRNCPSSDDTYFFCREKDHWEDNCELKKTLEQMKCLEQKFKSLDKKSRSHPYYNRKEKV
LLTSRVQFREQQLMLRMC
Download sequence
Identical sequences A9SX83
jgi|Phypa1_1|166998|estExt_fgenesh1_pg.C_1310102 XP_001770972.1.60028 3218.JGI166998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]