SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI171609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI171609
Domain Number - Region: 276-302
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000157
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number - Region: 340-397
Classification Level Classification E-value
Superfamily RING/U-box 0.000271
Family Zf-UBP 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI171609
Sequence length 489
Comment (Physcomitrella patens)
Sequence
MSTPSNFYKNSAYKYARDFDLSSVLDNLRAYRVATGSDPGPLDTNPGQELQHGKTEGRRD
KEKHHPYSRVKSKKTEEKRSSIIQASDVAKFNLESLGYNPFADAGPRGNASSVLGFDAYE
RSSDSKRGSQAGRVNAPDRNALSSLLGFNSIGDNSSDDEDTDTDVGVSSTVNGSSTVLEQ
QNCSDQIIAKRVDQKFAAPGEPECVVCGRFGAYICDETEDDVCSLECKQEVLQLRTANRV
KLTSESDVSFRAPSTPQGALQLPEEEPDKWDYKKNRYNYRHTSLSTFRCWKCKRPGHLPE
DCVVSMGIPAQSSSDSRQYNVPPTFSAGPMLQDLYRRCKEIEGQAKASKCDKCGINFNLA
YCLDCGKTFCDSQGHLSSHMQENPSHRRMYSRKLHRLVKCCKGPCPVVDMRELLACNSCL
SEAFDKYYSMYNATWKGAGLKLIVNAICCDAHFNWHRMNCGNVDVEDSASLLRKDGSDLH
GSQFNEFLF
Download sequence
Identical sequences A9TS20
XP_001781419.1.60028 jgi|Phypa1_1|171609|estExt_fgenesh1_pg.C_3020021 3218.JGI171609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]