SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI171782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI171782
Domain Number 1 Region: 45-60
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000167
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI171782
Sequence length 710
Comment (Physcomitrella patens)
Sequence
MRGGDWQLHSGAAYHFNCMDRSRGFGGHQFDGPAQVFSRPDFVRNCFNCGQPGHLARECQ
GRGFRGVGLHVDYFGRDVQQRAWPYAGIRPVALHPREAAFLLSRDDGPQGWQQQITVDFS
DSRTLGYVGRDSGNQNIPFLPNRMGDRPRDRRTGWVDFVAPSNPPLYSRGSDESHRKFTS
RRTTAKARISPLRRIAAARKDSEENDLCFRTLDNANSRACEEIKRGFSTEAEATNSHGGK
VEFSGIKPQMERDNGSEFASEHPELQVVVSACSDLDVMRASYDNEAEPRSQGRDSLTHGS
NAGQSSFSNTEKIDSDLENGEFVSVGDDDDPVFQQSFAELSSRGSHEKNAAIKVMHYSDL
ESVMVKSGVDNDRDVRSCPGNPPSLRIDTAMKELEAIDSLKRRSNGNGRDGAEFLPARKS
MHQSRHGGVCHGVSQSNSSPAGIVDSIKVRNLDGEVDYCNDFSVDPSASSDIFKRRSDCN
VSEVEFKSSDTNLNVHCNDFGSTLSACMDRELQRPSNGDDSSGSGRDLNMSSGWTGHHSN
YWNNSHNSNECVDTGKYDSGGFAGLPRNANTSLFPRRSVLPELTERQFPSVQTMENGDMK
EYSPAEQKVCVHMKLVPRARSQQQCTACQAEVGITLINESERFNSNNAGKVDVCMKGDLT
PTGDKGTLKAVTGINLETGVCVEQYNIDARVEKLMLNFPLVQGREQESVA
Download sequence
Identical sequences 3218.JGI171782 jgi|Phypa1_1|171782|estExt_fgenesh1_pg.C_3110010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]