SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI172211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI172211
Domain Number 1 Region: 245-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000179
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Domain Number 2 Region: 202-236
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000001
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI172211
Sequence length 349
Comment (Physcomitrella patens)
Sequence
MGLGVGACEVLSVEVLGRMSYTEEDTAGRPKLSLQPRGSASDTASPSPAKSSRPNPFGAA
RPREQVIAERTGKKEQEVLKEQAAKEWKKNIVLTEQQREDKKAAEAELAFARSELDKEVD
PTKSKALREEVNLMEKKLDELLVSFEKIAVQTAQSGGLRRPRREEERAPAAVAPVYGGGE
AEGYSNFSRGRERDGGRGSSYGDAWGGAKGGNKGEQGCYHCGEVGHFQRECPNGGGSRGG
AGGYGGNFGGGGGGGRGGGGRPCYTCGQEGHFARECPQGANVGGGYGSRGGGSYGGSYGG
GGYGGGYGGGSSYEDNAQYAYQGSSYGAGGYDDRGYSSGGRSGSYNPNW
Download sequence
Identical sequences A9TVK2
XP_001782648.1.60028 jgi|Phypa1_1|172211|estExt_fgenesh1_pg.C_3360019 3218.JGI172211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]