SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI173665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI173665
Domain Number 1 Region: 7-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000236
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI173665
Sequence length 296
Comment (Physcomitrella patens)
Sequence
MTSTVRATGCYKCGKPGHWSRDCPSQPASENPTPGSASVPSSSGVFAAAKGGTQASTQGF
KRKEPWRGGEKSGSFGPREKPAKARVPPRRMPKLTPDLLLGDDGLGYVLEKIPRQVNIRG
RGHEVEDLKSLLEAYVRWHQNLLPYYSFSQFVEKVEKVGSTKRVRLCVRELRSKVEKEKN
SLGADANSNADDDEAPDTKWEENDGDAAEDHGDPPMDVLEEHLRESAHASVSNLVEAAPA
SAPRPTIVIGPEPSTVAQQELKEEQRARMEANKQKALERARARKLELEKANSTPLT
Download sequence
Identical sequences A9U4S6
XP_001785861.1.60028 3218.JGI173665 jgi|Phypa1_1|173665|estExt_fgenesh1_pg.C_5350001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]