SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI180264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI180264
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-20
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 129-183
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000025
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI180264
Sequence length 187
Comment (Physcomitrella patens)
Sequence
MEEVGASVNVGAKETGKVKWFNSSKGFGFITPDKGGDDLFVHQTSIHAEGFRSLREGEVV
EFQVESSEDGRTKALAVTGPGGAFVQGASYRRDGYGGGGDGGGRGFGGSGARGRGRGGRG
SGGFGGVGGGDRPCYNCGEGGHIARDCQNEPTGSVRQGGSGAGGSRNCHTCGEAGHFARD
CTPAAAS
Download sequence
Identical sequences A9S1L9
PP1S41_68V6.1 3218.JGI180264 XP_001760145.1.60028 jgi|Phypa1_1|180264|estExt_gwp_gw1.C_410063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]