SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI180785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI180785
Domain Number 1 Region: 515-636
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000171
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 
Weak hits

Sequence:  3218.JGI180785
Domain Number - Region: 210-261
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0032
Family Bcl-2 inhibitors of programmed cell death 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI180785
Sequence length 648
Comment (Physcomitrella patens)
Sequence
MASDERESRTGHGEVVPLVHKVEVPPKRNVFQEIGSELWELFFHDAPVDQFKGQTKMKKG
ILSLKFIFPILDWIPKYNYKMLIADIISGCTIASLAIPQDLGYAKLAGVPPVNGLYSSFV
PPLVYAVFGSSRDIAIGPVAVVSLLMGTLLKQEIDPIQDPVNYLKLAFTATFFCGIFQAG
LGVFRLGFVTEFLSHAAIVGFMAGAAITIALQQLKGLLNITNFTTDTDFVSVMRSVFGHI
DEWNWRSIVIGLAFLAFLITTKTMAKKKKKLFWVSAIAPLTSVGLSTLFVFLTRVDKHGV
KIVGHIKKGINPVSIGDIFFSGSLAAAGAKVGLIAAIIALTEGVAIGRTFAALRDYHIDG
NKEMIAFGVMNLCGSFTSCYVATGSFSRSAVNYQSGVCTAMSNVIMAIVVLVTLLVLTPL
FKYTPNCILSAIIISAVLSLIDLRAALLIWKIDKFDFLACLGAFVGVFFVSVEIGLLIAV
CISFVKILYNVTRPHTARLGNIPGTNVYRNVTQYPNATLVPGILAIRVDAAIYFSNSNYI
HDKILHYLEEEMQRLSKSDGAPIKYLIVDLTPVTNIDTSGIIAFEELEKTLKRKNIQLAF
ANPGASVIIKLDDSKFLAHLGSEWVFFTVSEAIQVCTMLLNQSASEQV
Download sequence
Identical sequences A9S391
3218.JGI180785 PP1S45_14V6.1 PP1S45_14V6.2 jgi|Phypa1_1|180785|estExt_gwp_gw1.C_450011 XP_001760822.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]