SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI183211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI183211
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-20
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 136-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000886
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI183211
Sequence length 198
Comment (Physcomitrella patens)
Sequence
MAEEGASVNVGAKETGKVKWFNSSKGFGFITPDKGGDDLFVHQTSIHAEGFRSLREGEVV
EFQVESSEDGRTKALAVTGPGGAFVQGASYRRDGYGGGGRGGGEGGGRGFGGGAARGRGR
GGRGSGGFGGERGGVGGGDRSCYNCGEGGHMARDCQNESTGNARQGGGGGGGVGGSRSCY
TCGEAGHFARDCTPAAAA
Download sequence
Identical sequences A9SBU8
XP_001763889.1.60028 3218.JGI183211 jgi|Phypa1_1|183211|estExt_gwp_gw1.C_640002 PP1S64_4V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]