SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI188047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI188047
Domain Number 1 Region: 174-411
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.02e-34
Family WD40-repeat 0.002
Further Details:      
 
Weak hits

Sequence:  3218.JGI188047
Domain Number - Region: 105-130
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00112
Family Retrovirus zinc finger-like domains 0.0077
Further Details:      
 
Domain Number - Region: 424-522
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0348
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI188047
Sequence length 675
Comment (Physcomitrella patens)
Sequence
MVVVQRESDAEESSEEEEEEEEEEEEFVDSDYEESKDVEDEEAEGDEGENAGGEEHEEEE
NEEEEKKQKKRKARITISLKGQKVCKVCKAKDHQAGFVGSVYLDCPNKPCYLCKKPGHTT
LTCPHRMATEHGVVAAPRRRALGLLDFVHERQFRSHVPTVHLPQAIPNKVDSAIIRLHSR
RVTYLEFHPTKDNILISGDKRGQVGIWDFEKVFNKTVHENIHCALVNNIKFHPWQDGMMY
TASSDGKVCFTDLESGTSNEVLDLNPDGWAGPSTWRMIHAMDLNNQRELALTADNFGFLY
QVDTRANKEVGKPTAVHKKGTKVVGLHCHPIDPDVFITCGNDHMARIWDMRMLSPDNCLA
TLTHPRVVNSAYFSPITGNKILTTCIDNRIRVWDNICSDLSEPSREIVHSHNFNRYITAF
KAEWDPKDRSECLIVIGRYISDDFNGVALHPIDFIDVSNGRLVEQVYDPSITTICTVNKL
HPRLDCMATGSSRSLFIWRPRDANDEVTEHENATTEVKKTVKIQVYEADGGKAGRAKGKK
NDDDDDDDFAILKKRAAAKMANGAGPSSAVKEKRKSITEDEDSSPSCPAKERSRRKSNTS
VEEEDSSPGTAEKKKRKDKVEDEDTSPSCTVKEKSKRKSNRKDEDSDNDSEPDPPKDIEP
ATPATTSGRQLRRRR
Download sequence
Identical sequences A9SST7
jgi|Phypa1_1|188047|estExt_gwp_gw1.C_1140136 XP_001769441.1.60028 3218.JGI188047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]