SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI189930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI189930
Domain Number 1 Region: 223-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.2e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000434
Further Details:      
 
Domain Number 2 Region: 461-567
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-28
Family Canonical RBD 0.00096
Further Details:      
 
Domain Number 3 Region: 341-386
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000272
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI189930
Sequence length 774
Comment (Physcomitrella patens)
Sequence
MVGRGGSGYSQNNGASEFGTGISSNEECKHYNYGAAPVENHNAVEGENGGARGVNGEGGS
DGNSDQNASAGVDGSSGKKRRSRWGPQEGEGEGNDAEGSGGKKRKSRWAAEEPNLPLLGQ
IQLPDFVKELTGGVDLDPELQALNIKLLDINRKLQTGMVLDPVGDGNRSPSPEPIYDNMG
IRINTREYRAREKLTRERQEVIAMLIKKNPAFKPPADYKPLKHYKKLYIPVKEYPGYNFI
GLVIGPRGNTQKRMEKETGAKIVIRGKGSVKEGRSAQKRDLKPDPSENEDLHVLVEADTE
DALEKAAGMVEKLLVPVEEGRNEHKRAQLRELAALNGTIRDDEYCRLCGEPGHRQYACPA
RHSTFKSDVSCRICGDGGHPTIDCPLKGSAQGNKMDDEYKNFLAELGGGEVGSARQSGPT
LALPGPQGSPSLPWAGGTTGGAAMGSGGGRSGPGGPGLGADDDANLYVGYLPSSVDDEGL
ARLFAPFGAVEHAKVIRDRLTGASKGYGFVKFSDPSSATAAVTHRNGYRLEGRVLAVRVA
GPAPPPRGVGGGNGGPPQNGDPMGGGGYAPQLPSGGPPRGPPGGGHMTPPPWATSPGPMP
QYNPYGPPPLGPNSYGPPISQGYGPPPQGQGHHGAPPGHYGGPYNSYAGGPPPQGGPQGQ
PGGVDVGVHGMPLHGPGMGGMPPGGQGGMGPRPGNTGPVGGMAVGGYGAATQYHGYYAPP
PSKPAPPIPPPSVSSGGDTAASSWGGNVGVTPVSSGQSNAVESEYERFMSEMGR
Download sequence
Identical sequences A9SYU4
jgi|Phypa1_1|189930|estExt_gwp_gw1.C_1380136 3218.JGI189930 XP_001771487.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]