SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI19499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI19499
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000837
Family TBP-associated factors, TAFs 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI19499
Sequence length 100
Comment (Physcomitrella patens)
Sequence
KRKRGLFNKDLRLMMYGFGDDPDPMPETVHLMEDILIDYITDTVHKSQNVASRRGKLTTE
DVMFLVRKDSRKFARVKELLAMNEELKRARKAFDLDEEKL
Download sequence
Identical sequences A9S121
jgi|Phypa1_1|19499|gw1.40.68.1 3218.JGI19499 XP_001759999.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]