SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI223358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI223358
Domain Number 1 Region: 132-196
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000441
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 
Domain Number 2 Region: 87-119
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000119
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI223358
Sequence length 197
Comment (Physcomitrella patens)
Sequence
MAEELDDDRDEEWFKEVYGTEYTAPARATGATRRAVEPAPPKVANKRAPNPSDSEEDEEQ
RDPTAVPTDFTSREAKVWEAKAKAVERNWKRRKEEELTCRLCGEVGHFAQGCPTTLGGNR
KPGEIVERIPLRDKRLKPRLIGTGGAIIQGIEKETGCRLKLEDNLTVGNGAFFVKITGPD
RVAVKMAMTSVNKLVDQ
Download sequence
Identical sequences A9TLA8
XP_001779380.1.60028 3218.JGI223358 jgi|Phypa1_1|223358|estExt_Genewise1.C_2570037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]