SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI229642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI229642
Domain Number - Region: 203-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00067
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI229642
Sequence length 249
Comment (Physcomitrella patens)
Sequence
MKNSFRNTQTRSSIENNEVTSGSSSSEQGGSERGAEETSATTFQEREQTRRPKTRAMGLL
RLSLTEVVKPYILHTFDPALAWEILAKSPSDTVIVHKVHKVLKCLSMKYETFVRILRIEK
ETQSLTSLASMLHMKETEMALRTEISKEALVFKIRNLLRGRQKPSCGAKSSNYFQTQARR
EPSSHRSNNRNVEERREHRFDQQCHQCGKPGHIARFYRAAEPQSTDRYKLRANLLKKTAG
ESYPTSREV
Download sequence
Identical sequences A9SGW2
XP_001765608.1.60028 3218.JGI229642 jgi|Phypa1_1|229642|fgenesh2_pg.scaffold_77000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]