SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI230287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI230287
Domain Number 1 Region: 426-614
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.7e-33
Family cAMP-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 81-283,359-420
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-17
Family Voltage-gated potassium channels 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI230287
Sequence length 696
Comment (Physcomitrella patens)
Sequence
MEYHRFNSYSSLDSIQSNREEILCYACSGVGPPLFHSTVCEKYPSSLETTPRTCLERRRH
IGYYRTKDSKSKWIFGEVLDPRNSTIRRYNKWFLLSCVLGAAVDPLFISVLSINKDLSCL
YVQKGYAIGVTILRCMVDLVYIWHMWLQLKLAYVSKKSLFLGQGELVWDARTVAIQYLRS
LPQFWFDIFVILPIPQVMLWVILPNQVVKGGDTTWIMNYMLLTFLIQYVPKVLRFIFIAW
RLQHVTGYIFGSASWGFVLNLAVYFCAAHVAGSIWYLLTVQRVESCIYLQCKGMTNCQVN
SYMGCPNPISYGAQPSSDTNRLAWAEDPAFDFQCLKGGAHSLTGNFSFGIYSLAVPIVQD
IRTPINRIVLPLFWGIMTMSSFGNALSPTPHIVEVTFSILVIICGLLLFTLLIGNIQVFL
HSTTARKVKSQLRARDIEWWMRRRQLPNEIRRRVRQYERHMWAATRGIDEVATIRDLPES
LRRDIKRHLCYELVRKVPLFEQVDDQILNIICERLKPKLFTKNETVLNEGEPVRQMLFIV
RGNIGSSYRLRHNRTSKCVLGPSHFCGDELISWCLSKPLRDNLPLSTTTLTTLTVTEAFA
LDALDLKYLTQHFQHKFANENLKRAVRSHSCSWQTWAAVTIQLGWRRHRARLSLSNTIAT
TTPDHSYADDHSETLRSLRLYAAILCSPKPKDYLSS
Download sequence
Identical sequences A9SNU5
3218.JGI230287 jgi|Phypa1_1|230287|fgenesh2_pg.scaffold_99000010 XP_001768026.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]