SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI27641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI27641
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000183
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 2 Region: 88-106
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000179
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Weak hits

Sequence:  3218.JGI27641
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00994
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI27641
Sequence length 106
Comment (Physcomitrella patens)
Sequence
ETCYNCGQQGHWAAECTKQAREKPCYVCGNFGHFSYDCPEALRCYICKRTGHMCCIDVSD
ASPTPVSCYRCGDLGHSGVVSISQDSYENQTACYRCGNEGHFAREC
Download sequence
Identical sequences A9RU85
3218.JGI27641 XP_001757670.1.60028 jgi|Phypa1_1|27641|gw1.28.192.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]