SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI50380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI50380
Domain Number 1 Region: 102-387
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-69
Family Tandem AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 607-638
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000712
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  3218.JGI50380
Domain Number - Region: 461-535
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00269
Family GUCT domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI50380
Sequence length 638
Comment (Physcomitrella patens)
Sequence
DEETLSSSDEEGFVGKKNAGAGKDELAIDSLGVSEDIVNALAKRGITHLFPIQRAVLEPA
MKGQDLIARAKTGTGKTLAFGIPIIQHIIDAHKESAPRHGRSPRALVLAPTRELAKQVER
EFMESAPMLSTVCVYGGVSISMQQRQLERGVDIAVGTPGRIIDLIDRGSLKLQNVNFLVL
DEADQMLAVGFEEDVERILQQLPKNRQSMLFSATMPKWVKELSGKYLNRPLMINLVGDAD
DKLAEGITNLAIQLPATAKRSILSDLITVHAKGGKTIVFTQTKRDADDVAMAMGNLVACG
ALHGDISQLQREKTLNAFREGNITVLVATDVAARGLDVPNVDLVIHYEIPNDSETFVHRT
GRTGRAGKTGTNILMFTNQQMRTMRTIESNVKCRFQMIGAPHVKDVMQASFDQVRGALKN
VDESLAAEFRPTAESLLEEKGPDAFAAALAHLSGFSQLPPSRSLLTHEPGMTTLRLMRSG
GRPALNARGVSGVLSGLSRSAADSVGKICIIDDRRVNGAVFDLPDDVAKEVLALPNQDGD
VFDVPTKLPPIISEERRGGQSSGMFGRFGGGSDSRGGMDRGNDRFGRFSSSSPRSSSSER
ERFGRFSSKQSDRGGDRTFSGTCHVCGQRGHRANDCPS
Download sequence
Identical sequences A9RFT8
jgi|Phypa1_1|50380|gw1.7.306.1 3218.JGI50380 XP_001753085.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]