SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI57148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI57148
Domain Number - Region: 188-211
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0196
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI57148
Sequence length 499
Comment (Physcomitrella patens)
Sequence
MKKTSNEEVEYKQKSGTAWSHSYLNQKPWHPLSYPNQRRKWIAEQQNAQKERKAEEVAHE
FAQQQEFFRQTSVMSKKEKEKVEALQAVGFMYMRPPGYNAESARAAEIADERRKLGLEAP
PSSSQAAPADVIPQGEAGGAEAEVKKKPRVKDVFGRNVATEAEFAVLKDAPKLDTGVVGR
VKPFAIEIRNVKCAKCGGFGHQSGDRECPLKDVITPNELERLKRNDPLQAIIAQATGDEP
FKWELKNQPGAMSPARGGFKPDDPNQQILADEDIYDEYGGFLAGGGDGEDLDGEGKLAMP
DILASLTKEQRKELAALRIDEKKRKEDRRKKKKKKRKIRKDSDSSESSDGSDKKEKQRRY
KHRSHKPKKKKSMSDVHRSERGHRSKHRYSESSLTDSSSESDGVATVLEPANASSRKYSE
DSDDSVDKRVTVSETHDKHHRRYSSSRSKEEKVHSKNRSHRRQKKAALHADLDEVHESFK
RERDKDYKEHRHDLSKHRR
Download sequence
Identical sequences A9S8A8
3218.JGI57148 PP1S55_269V6.1 XP_001762513.1.60028 jgi|Phypa1_1|57148|fgenesh1_pm.scaffold_55000032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]