SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI6051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI6051
Domain Number 1 Region: 78-127
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000121
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 
Domain Number 2 Region: 26-74
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000014
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 
Weak hits

Sequence:  3218.JGI6051
Domain Number - Region: 127-156
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI6051
Sequence length 188
Comment (Physcomitrella patens)
Sequence
GGSSGVPKKTKVASSSKHPLRQAGMKPGEGCFLCKSKDHIAKHCPTKSEKDHRKNYMCLG
CRMWGHTLKNCPSEFKSADVKLCYNCGQPGHSLDKCPNPLKDGGSAFAECFLCKQRGHLS
KNCPDNKNGIYPKGGSCKICEQVTHLAKDCPQKNSGKFAGNARISSGVGGKRTVFKSGDD
LEDDFQDE
Download sequence
Identical sequences A9TUQ2
3218.JGI6051 jgi|Phypa1_1|6051|gw1.327.14.1 XP_001782328.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]