SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI63758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI63758
Domain Number - Region: 32-101
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0288
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI63758
Sequence length 124
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLAMIPEVRDHITSITDRCGNSWEDFSHALKDKYFLEDADHVTKK
LFLGWIERPNKNLQATELLRKFERQYSQLSKVEKLTLEQNKVDLFLQAADGELQEKLEPL
LEDK
Download sequence
Identical sequences A9RB42
jgi|Phypa1_1|63758|fgenesh1_pg.scaffold_1000132 3218.JGI63758 XP_001751490.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]