SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI63814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI63814
Domain Number - Region: 262-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0204
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI63814
Sequence length 842
Comment (Physcomitrella patens)
Sequence
MQQQQSNDRKEALTTKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGL
ATIPEIRDHITSITDHCGNSLEDFSHALKDEYFLEDADRVTKKLFLGWIERPNKNLQGTE
LLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLELLLEDKEEDEGLTTKWKNV
EDAVELLTKKKRRKDRSNIPKTVQAPKAPIRTTPPTMPTFQPSTSLSKKADMRMEEIIRG
MRDLQIKLARLEENTSTNNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRRGIICWK
DGKIALKDREDLLQTNFGKGGMRALVQDYLKEHKTTTRESASYGVRVDDEIGGSTETSEF
WTSAISTMQEGKLPREALLRTAAIIRGRTSWEDPVESLSVHTYIAKSQHEALMEEKRRGN
FDDTREENSSKRQTQGDKAREAASQELPVKDTSASLEEKRKETKNKGKSIAYKLLSDIEA
ATDLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMGETGMSHAIDARI
YRDEEEVDIGYKQPTNEKNGDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVPLVDHG
SEINLMSKDLYKKQKWSIDMEHGWAIRAANNTGGELYGACPDVKIRIRDVVTEQHFFVQD
TKSYPLIIGQPYITATRMETKVLDDGSAYVRVHSKDERKAVQFLTVPPNHERNRDRLREK
PLPKIVEGFKDFGEIPLLMILKEKKEKRLYDIERQLRKLGTLQDDERILGVYEENGLEDS
LELITSIGLGDNDKIVEIHSREVYIILESFQAPEVTVEARYKTADKKVEPVAGPLPEILK
NK
Download sequence
Identical sequences A9RB92
3218.JGI63814 jgi|Phypa1_1|63814|fgenesh1_pg.scaffold_1000188 XP_001751516.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]