SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI63958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI63958
Domain Number - Region: 173-203
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00733
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI63958
Sequence length 253
Comment (Physcomitrella patens)
Sequence
MIAKKLYQPKHCKQWSIKLINLMEGIFQATELLREFERQYSQLSEVEKLTLEPNKVELFF
QAADRELQGKLELLLEDIEEDEGLTTKWKNVESAVGLLVKRERRKDRSNIPKAVQAPKIP
IHTTRRTMPAIQPSTSLPKKANMEIEEIIRGMRDLQIKLVSLEENTSTNNLKNVSKQGYV
QRCIWCDDASHTKKDCDEFNNMIWQEVICLKDGKIALKDMEVLLKTNFGKEGMRALIQDY
LKAHETAAHCRNM
Download sequence
Identical sequences A9RBM5
XP_001751346.1.60028 jgi|Phypa1_1|63958|fgenesh1_pg.scaffold_1000332 3218.JGI63958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]