SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64210
Domain Number - Region: 457-539
Classification Level Classification E-value
Superfamily Acid proteases 0.0169
Family Retroviral protease (retropepsin) 0.049
Further Details:      
 
Domain Number - Region: 186-224
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0204
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64210
Sequence length 708
Comment (Physcomitrella patens)
Sequence
MSEIRDHIASITDRYENSWEVFSHALKDEYFLEDADHVTKKLFLEWIERPNKNLQVTELL
GEFERQYSQLSKVEKLTYEPNKVDLFYQAADGEMQGKLELLLEDKEEDEGLTTKQRRKDR
SNIPKIVQVPKTPIRTTPQIMPTVQPSTSLSKKANMEMEEIIRGMRDLQIKLARLEENTS
TNNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDRDDLLQTN
FGKGGMRALVQDYLKELETAARESASYGVRVDDDLGGSTETKGDSSKRQTRGDKAREAAS
QELPVKDTSASLGEKTKETKDKGKSIAYKLLSDIEVATNLKGMLEERILNAKVEFPLKEV
LGIVKKEFHDVIIDSINQKRKLMGETGMSHAIDARIYKDEEEVDISYKQPTNEKNGYNQR
VCFKDYRDKEMETLSHYTRKYWARATTKILVKVRDIEEPIVALVDHGSEINLMSKDLYKK
QKWPIDMEHGWAIRAANNTWGELYGACPDVKIWIGDVATEQHFFVQDTTFYPLILGQPYI
MATRIETKIVEINSREVYIIFESFQAPEVTVETRYKTADKKVKPIARSLPEDSKEQIGEA
SKEASLRDPMRIGHQFTKETFEELKIGSDGSLLLEEITCFKKMLTKQDRRLLLIFSYLEY
WEQRPIPVQILRGQGQSPRYSQPGHTEMLRSILITGVSRKEKDQFNDG
Download sequence
Identical sequences A9RCT4
jgi|Phypa1_1|64210|fgenesh1_pg.scaffold_2000087 3218.JGI64210 XP_001751714.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]