SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64304
Domain Number - Region: 245-286
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0115
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 519-604
Classification Level Classification E-value
Superfamily Acid proteases 0.0337
Family Retroviral protease (retropepsin) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64304
Sequence length 908
Comment (Physcomitrella patens)
Sequence
MDPSIASMFQAFSLSMQQQQSNDRKEALATKALQAMVNKIDQFDGRNISRDHITSITDRY
GNSWEVFSHALKDKYFLEDADRVTKKLFLEWIERPNKNLQATELLREFERQYSQLSKVEK
LTLEPNKFDLFLQAADGKLQGKLELLLEDKEEDEGLTTKWKNVEDAVELLTKRERKKDRS
NIAKTVQAPKAPVCTTPPTMPTVQPSTSLSKKADMEMEEIIRGMRDLQIKLARLKENTST
NNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKVGKIALKDREDLLQTNF
GKGGMRALIQDYLKEHETAARESASYGARVDDDLGGSTETKKRRGNFDDTREGNFSKWQT
RGDKAREAASQELHVKDTSASLEEKTRETKDKGKLIAYKLLSDIEAATNLKGVLEERILN
AKVEFTLKEVLEIAKKEFHDVIIDSIKRKRQLMGETGMSHAIDARIYRDEEEVGIGYKQP
TNEKIGYNQRVHLEDSSDKEMGTLSHYTRKHWARATTEVLVRVGDIEEPIVALVDHGSEI
NLMSKDLYKKQKWPIDMEHGWTIRAANNTRGELYGACPDVKIWIGDVTMEQHFFVQDTTS
YPLILEQPYITATRMETKVLDDGSAYARIRSKDGRKAIGTLQDDERILGVYEENGLEDSL
ELITSIRLADNDKIVEIHSREVYTMLESFQAPEVTVETRYKTAHKKVKPVVGPLPEDSKE
QMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSLLSEEITCFKKMLAKQGRSFAFES
HEIGQPRHTEMLRSIPITRVSRKRKDQFTRQVSSFEEPIGSNFKNLIWVLLPNMRPALVG
QPNAVYLRENPGLATGLSQSDTKDQFDPITRTSRFLKIKEIGEELHASGRGRKDRELGFF
FFIGFWED
Download sequence
Identical sequences A9RD18
XP_001751949.1.60028 jgi|Phypa1_1|64304|fgenesh1_pg.scaffold_2000181 3218.JGI64304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]