SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64360
Domain Number - Region: 148-241
Classification Level Classification E-value
Superfamily Acid proteases 0.00608
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Domain Number - Region: 804-843
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64360
Sequence length 955
Comment (Physcomitrella patens)
Sequence
MRALVQDYLKEHKTAARESASYGARVDDDLGGSTETSTIRGATGWEDPVESLSVHAYIAK
SQYEALMEEKRRGNFDDTREGNSSKRMSHAIDARIYKNEEEVDIGYKQPTNKKNGYNQRV
HFEDYSDKEIETLSHYTGKHWTSATTEVLVKVGDIEEPIIALVDHGSEINLMSKDLYKKQ
KWPIDMEHGWAIRAANNTQGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYIT
ATRMETKILDDGFAYARLDTLEDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSR
EVYTILESFQALEATVETRYKTTDKKEITSFKKKLAKQGRLFAFKSHEIRYLEYWEHRPT
PVQILSGRVQSLRYSQQGHTEMLHSIPITGVSRKRRTNSQDGFEEPIGSNFDNPIRAVLF
SVPFQGTLFSVNGFLKGKNGGESLTARANFGSKLEWIQDRKYKAVLKVNSLGCTGFSVTS
RDLLAGAKRTSIEHPYGVTSKIDRLLDYRQISILPSTARRPAHSRAGKHDFWEKFLVGSL
LKDKQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALF
GLATIPEIRDHITSITDRWGNSWEDFLHALKDEYFLEDADRVTKKLFLGWIERPNKNLQA
TELLREFERQYSQLSKVEKLTMEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWK
NVEDAVGMLTKKERRKDRSNIPKPVQAPKAPVRTTPPTMPTVQPSTSLSKKADMDMEEII
RGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIIC
WKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVVQESASYGARVDDEIGGSTETS
EFWAFAVSTMQEGKLPREADSTGSSQPVAPRIVPAVLYNASQGNFPSCIVEMVEA
Download sequence
Identical sequences A9RD75
jgi|Phypa1_1|64360|fgenesh1_pg.scaffold_2000237 3218.JGI64360 XP_001751979.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]