SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64389 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64389
Domain Number - Region: 181-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00207
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64389
Sequence length 863
Comment (Physcomitrella patens)
Sequence
MASGGVPSVPTGPPVPPIGPIGLAVPISVPMGQVGDRTTSIAPLPIFSGWPGADPDQHLS
QFLTACVANNGRTEDVCNLANSITGAMAPATHSTIPIQGVLNPVLLQAVPSPMASTYPQF
APYQPLGVNTQELPMLPGSKETNEMLLLNLTKKMEELAVNMAKEKKKRPKQTNFRANVWY
TNCKGQGHMVQDCPSLGNMKIQCMNCGGKHPTNNCWYLSNPHFNNTMSPSMSWDVQIQSS
QEDTNPVLQDSPVNHIEVVQAVQTRGQRNLQSILKKDKIIEEQPEPIQKKATIFAKSANQ
LQTVLVPTDSFNSTPIAPGGVNSQCPVQSIPIETVPTLSRIPISAPIEPPNSVSQSNKDF
TMARRLKRTKERNDRSRNVRFRNELPELELVTFTNMENCQIDLLWQRKFEKDFKEADVYG
FLRYSRVLPPLDPSIVEEFVQHYDPLDGSSVVHNRIVGLEVPILHKVLYLPIGELAVGSE
VTVEFNPELYFRSKADAFVKGQGWKVLDVLKPEVGEWLRFVQKRMALNRHTTYIAKNFLF
AVVASMDGMKFNWAEFVAQRMHNELSYKRTLRKVTTLLCSNYISEVVKYQLKLPLQEQEK
ARLKKSGKVVTLEERQKETERAKSPEQIVQNQQEQTNQPSIAVGTSSKGKEKLDQRPEPS
LALVLPNRLTGETSTQFEGQHSSGDKWGSAKEMLLYQVETLLPQFNKLHRMVHELQDSDE
LSKDLENQKKLVATQQKTIAELEEKLAEKVTKYTELEVRLNKMDKDWRMDRMLHQAVEDL
SKQERDLARTQLQESLEKCTKLEKEHQQTLLEVATIWDRIGNLEAELDLTRQPVSTSNFE
EVAELKTKLDDHQKYIVRLEEQV
Download sequence
Identical sequences A9RC38
3218.JGI64389 XP_001751997.1.60028 jgi|Phypa1_1|64389|fgenesh1_pg.scaffold_2000266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]