SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64539
Domain Number - Region: 46-76
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00523
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64539
Sequence length 199
Comment (Physcomitrella patens)
Sequence
MPIVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTNNLKNFSKQGYVQRCIWCD
DASHTRKDCNEFNNIIRQGIICWKDEKIVLKDREDLLQINFDKGGMRALVQDYLKEHETA
TWKSVSYGARVDDDLSASTKTSEFWASAISTMQEGKLPQEALLRTTATIRGATDWKDPVE
SLSVHAYIAKSQHEAFMEE
Download sequence
Identical sequences A9RCI8
XP_001751868.1.60028 jgi|Phypa1_1|64539|fgenesh1_pg.scaffold_2000416 3218.JGI64539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]