SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64544
Domain Number - Region: 12-46
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000488
Family Retrovirus zinc finger-like domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64544
Sequence length 219
Comment (Physcomitrella patens)
Sequence
MAVNMAIDKEKRQKPTNTRTNVWCNNCKGHDHSVTECPSPSQIMGQLNRVECVQAVLTRS
QQKGKGPIQYLDNPDAKDQFDPIRGPSNPGLVTGFVPNMRRDSMAQPNEVSITEASVPFQ
AVPISTQFRETSYLLKDPLGGGNSKEAPAIVPIPSPGRKNILPHGILKLDAQVSILDEYN
EDLSNQLRKESMDKLKEEEEDVQLESDLVERTLDNAAND
Download sequence
Identical sequences A9RCJ3
XP_001752080.1.60028 jgi|Phypa1_1|64544|fgenesh1_pg.scaffold_2000421 3218.JGI64544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]