SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI64584
Domain Number 1 Region: 213-242
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64584
Sequence length 568
Comment (Physcomitrella patens)
Sequence
MAMGGSAVPITVQIGDMSDRTTSVAPLFTFRGFLGIDLDQYLSQFLTACIANNRRTEDIW
LRWLLAILNDTTFEWYNRQSVGQFLYWEALKNAFLIHFWPISFEDHLRESYQNPTLNGSV
DACLWMLDTRANIGANIQGRVNVTPLQAIPPNMTTTYAPYFPYQQQALTAIKLPIISAPK
DSNEALLLNLTKKMEKMVVNMAKDKEKRQKPINTSTNVWCSNCKGHGHLVTECPSPSQMM
DQWSASNPQNYRKEQQRYQQYALPTSSNQVSSAPIAQPRSLSNPTWNKPNRYILMETSNM
PNGAILIKSQQKEKGLIQYLGDPEAKNQLDPIMGTSNLGPITGFFSSMQLDSIGLSNEVS
IMGASDPLQVVPFSMPFRKISCLLKDPLGGLNSKEAPSVVLILSPRRKNILSQGVKLQPM
KRKRVLDITLNMESYDILKDLDAIRPFISMKQLLPVAPECRSTFNLSLTRHLQRNKKVCQ
VSLNPDPSTPTIDVSIDGIVILCVQMDGGSSVNLMKADTMDALDLEHLVLTTLVLRMADH
SWIKPMDILRCVQTIITGIAYAIDYIIF
Download sequence
Identical sequences A9RDD2
3218.JGI64584 jgi|Phypa1_1|64584|fgenesh1_pg.scaffold_3000036 XP_001752104.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]